PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009629706.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family HD-ZIP
Protein Properties Length: 212aa    MW: 24903.1 Da    PI: 5.2731
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009629706.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.37.1e-2049101456
                     -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     ++++++eq++ Le+ F k++++  e++ +LA++lgL+ rqV vWFqNrRa++k
  XP_009629706.1  49 KRKLSEEQVNLLEQSFGKEHKLESERKDKLASELGLDPRQVAVWFQNRRARWK 101
                     45899***********************************************9 PP

2HD-ZIP_I/II121.83.5e-3948139293
     HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                     +kr+ls+eqv+lLE+sF +e+kLe+erK +la+eLgl+prqvavWFqnrRAR+ktk+lE++y++Lk+++d+   +n+rLe+ev +L+e+l+e
  XP_009629706.1  48 RKRKLSEEQVNLLEQSFGKEHKLESERKDKLASELGLDPRQVAVWFQNRRARWKTKKLEEEYSKLKSEHDTNIVHNCRLENEVLKLKEQLSE 139
                     8****************************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.29743103IPR001356Homeobox domain
SMARTSM003897.8E-1946107IPR001356Homeobox domain
CDDcd000862.61E-1648104No hitNo description
SuperFamilySSF466891.97E-1849112IPR009057Homeodomain-like
PfamPF000465.3E-1749101IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.7E-2150110IPR009057Homeodomain-like
PRINTSPR000318.5E-67483IPR000047Helix-turn-helix motif
PROSITE patternPS00027078101IPR017970Homeobox, conserved site
PRINTSPR000318.5E-68399IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 212 aa     Download sequence    Send to blast
MNLQVDDQMI LISQYYPGIY TQELPEQGEA KQRRRRKKNK GEASEVMRKR KLSEEQVNLL  60
EQSFGKEHKL ESERKDKLAS ELGLDPRQVA VWFQNRRARW KTKKLEEEYS KLKSEHDTNI  120
VHNCRLENEV LKLKEQLSEA EKEIQRLLME RCDGVNSSNS PTTSSLSMEA ANMEPPFLGE  180
FGMEGFDNTF YVPENTYSQG LEWVNLYMPY DV
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13350RRRKKNKGEASEVMRKRK
23550RKKNKGEASEVMRKRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009629706.11e-157PREDICTED: homeobox-leucine zipper protein ATHB-40-like
SwissprotO232082e-73ATB40_ARATH; Homeobox-leucine zipper protein ATHB-40
TrEMBLK4BB741e-103K4BB74_SOLLC; Uncharacterized protein
STRINGSolyc02g085630.2.11e-102(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12892480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36740.12e-64homeobox protein 40